Specialtyansweringservice.net Specialty Answering Service | Call Center Service Provider

Telephone answering services and call center services by SAS. 24-hour live outsourcing for fast growing companies. Prices start at $31/month. Try us F...


Online Status
Offline

Server IP address resolved: No
Http response code: None
Last Checked: 02/25/2024

Specialtyansweringservice.net traffic volume is 641 unique daily visitors and their 1,025 pageviews. The web value rate of specialtyansweringservice.net is 9,373 USD. Each visitor makes around 1.71 page views on average.

By Alexa's traffic estimates specialtyansweringservice.net placed at 45,796 position over the world, while the largest amount of its visitors comes from United States, where it takes 216,917 place.

Perfect for specialtyansweringservice.net that their data center (provided by company company GOOGLE-PRIVATE-CLOUD - Google LLC, US) is located in United States, as that empowers most of the visitors to reduce the page load time. See the list of other web pages hosted by GOOGLE-PRIVATE-CLOUD - Google LLC, US.

Specialtyansweringservice.net registered under .NET top-level domain. Check other websites in .NET zone.

The last verification results, performed on (June 17, 2019) specialtyansweringservice.net show that specialtyansweringservice.net has an expired wildcard SSL certificate (expired on January 19, 2020). Click “Refresh” button for SSL Information at the Safety Information section.

In accordance with Google Safe Browsing, Google Safe Search and Symantec specialtyansweringservice.net is pretty a safe domain.

Relying Google MobileFriendly test specialtyansweringservice.net is well optimized for mobile and tablet devices, however web page loading speed may be improved.


Global Rank
712,446
Average Load Time
1.03sec
Links In Count
127
Website Value
$8,760

Overview
Last Updated: 02/25/2024
Overall result - specialtyansweringservice.net is safe.
We gather website safety and reputation data and compare it with available third-party sources so we calculate own safety and trustworthiness rate based on information that we get.
Norton Connect Safe
Last Updated: 04/03/2023
specialtyansweringservice.net is safe.
Norton ConnectSafe evaluates specialtyansweringservice.net for any unsafe and insecure content. The results are critical for families with young children.
Google Safe Search
Last Updated: 01/16/2017
specialtyansweringservice.net is safe.
SafeSearch is used as a parental control tool to filter out any inappropriate for your children search results on your devices: phones, tablets or personal computers.
Google Safe Browsing
Last Updated: 01/09/2019
specialtyansweringservice.net is safe.
Malware: not found.
Phishing: not detected.
Unwanted software: not found.
Harmfull applications: not found.
Google Safe Browsing notifies when websites are compromised by malicious actors. These protections work across Google products and provide a safer online experience.
Site Advisor
Last Updated: 03/03/2021
specialtyansweringservice.net is safe.
McAfee assesses specialtyansweringservice.net for a meaningful set of security threats. Featured dangers from annoying pop-ups to hidden Trojans, that can steal your identity, will be revealed. McAfee does not analyze specialtyansweringservice.net for mature or inappropriate content, only security checks are evaluated.
Web of Trust
Last Updated: 02/25/2024
specialtyansweringservice.net child safety is unknown.
The WOT calculates reputation of the specialtyansweringservice.net. This reputation system receives ratings from users and information from third-party sources, assesses the specialtyansweringservice.net for safety features and confirms, whether specialtyansweringservice.net is suitable for children.

SSL Information
Domain*.specialtyansweringservice.net
Issuer OrganizationUnknown
IssuerDigiCert SHA2 Secure Server CA
AlgorithmRSA-SHA256
Valid form01/12/2018
Expiration01/19/2020
SignedCertificate is not self signed
Additional Domains *.specialtyansweringservice.net
specialtyansweringservice.net
Server Location

ASN Information

ASN ID: 396982
ASN Title: GOOGLE-PRIVATE-CLOUD - Google LLC, US

Last Update: 01/04/2024

#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/resources/registry/whois/tou/
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/registry/whois/inaccuracy_reporting/
#
# Copyright 1997-2019, American Registry for Internet Numbers, Ltd.
#

ASNumber: 396982
ASName: GOOGLE-PRIVATE-CLOUD
ASHandle: AS396982
RegDate: 2018-08-15
Updated: 2018-08-15
Comment: *** This ASN is used for Google Private Cloud ***
Comment:
Comment: Direct all copyright and legal complaints to
Comment: https://support.google.com/legal/go/report
Comment:
Comment: Direct all spam and abuse complaints to
Comment: https://support.google.com/code/go/gce_abuse_report
Comment:
Comment: For fastest response, use the relevant forms above.
Comment:
Comment: Complaints can also be sent to the GC Abuse desk
Comment: (google-cloud-compliance@google.com)
Comment: but may have longer turnaround times.
Comment:
Comment: Complaints sent to any other POC will be ignored.
Ref: https://rdap.arin.net/registry/autnum/396982


OrgName: Google LLC
OrgId: GOOGL-2
Address: 1600 Amphitheatre Parkway
City: Mountain View
StateProv: CA
PostalCode: 94043
Country: US
RegDate: 2006-09-29
Updated: 2017-12-21
Comment: *** The IP addresses under this Org-ID are in use by Google Cloud customers ***
Comment:
Comment: Direct all copyright and legal complaints to
Comment: https://support.google.com/legal/go/report
Comment:
Comment: Direct all spam and abuse complaints to
Comment: https://support.google.com/code/go/gce_abuse_report
Comment:
Comment: For fastest response, use the relevant forms above.
Comment:
Comment: Complaints can also be sent to the GC Abuse desk
Comment: (google-cloud-compliance@google.com)
Comment: but may have longer turnaround times.
Comment:
Comment: Complaints sent to any other POC will be ignored.
Ref: https://rdap.arin.net/registry/entity/GOOGL-2

OrgTechHandle: ZG39-ARIN
OrgTechName: Google LLC
OrgTechPhone: +1-650-253-0000
OrgTechEmail: arin-contact@google.com
OrgTechRef: https://rdap.arin.net/registry/entity/ZG39-ARIN

OrgAbuseHandle: GCABU-ARIN
OrgAbuseName: GC Abuse
OrgAbusePhone: +1-650-253-0000
OrgAbuseEmail: google-cloud-compliance@google.com
OrgAbuseRef: https://rdap.arin.net/registry/entity/GCABU-ARIN

OrgNOCHandle: GCABU-ARIN
OrgNOCName: GC Abuse
OrgNOCPhone: +1-650-253-0000
OrgNOCEmail: google-cloud-compliance@google.com
OrgNOCRef: https://rdap.arin.net/registry/entity/GCABU-ARIN

#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/resources/registry/whois/tou/
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/registry/whois/inaccuracy_reporting/
#
# Copyright 1997-2019, American Registry for Internet Numbers, Ltd.
#

WHOIS

Domain Name: SPECIALTYANSWERINGSERVICE.NET
Registry Domain ID: 133291286_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-10-21T17:12:56Z
Creation Date: 2004-10-20T18:03:46Z
Registry Expiry Date: 2022-10-20T18:03:46Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS55.DOMAINCONTROL.COM
Name Server: NS56.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-11-24T07:34:17Z


DNS Records
HostA RecordTTL
specialtyansweringservice.net104.196.185.75600
HostMX RecordPriorityTTL
specialtyansweringservice.netalt1.aspmx.l.google.com53600
specialtyansweringservice.netaspmx.l.google.com13600
specialtyansweringservice.netalt2.aspmx.l.google.com53600
specialtyansweringservice.netaspmx2.googlemail.com103600
specialtyansweringservice.netaspmx3.googlemail.com103600
HostNS RecordTTL
specialtyansweringservice.netns55.domaincontrol.com3600
specialtyansweringservice.netns56.domaincontrol.com3600
HostTXT RecordTTL
specialtyansweringservice.netv=spf1 include:_spf.google.com include:helpscoutemail.com ~all3600

ns55.domaincontrol.com
TTL: 3600
Email address: dns.jomax.net
Serial: 2019091300
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum: 600


Errors
Warnings

Last tested: 06/29/2019

Desktop
Desktop Speed
75%

Desktop Resource Breakdown
Total Resources75
Number of Hosts17
Static Resources60
JavaScript Resources11
CSS Resources3

Last tested: 06/17/2019

Mobile
Mobile Usability
95%
Mobile Speed
57%

Mobile Resource Breakdown
Total Resources73
Number of Hosts16
Static Resources59
JavaScript Resources11
CSS Resources3
www.specialtyansweringservice.com
www.specialtyansweringservice.net
www.specialtyansweringservice.org
www.specialtyansweringservice.info
www.specialtyansweringservice.biz
www.specialtyansweringservice.us
www.specialtyansweringservice.mobi
www.pecialtyansweringservice.net
www.specialtyansweringservice.net
www.wpecialtyansweringservice.net
www.swpecialtyansweringservice.net
www.wspecialtyansweringservice.net
www.epecialtyansweringservice.net
www.sepecialtyansweringservice.net
www.especialtyansweringservice.net
www.dpecialtyansweringservice.net
www.sdpecialtyansweringservice.net
www.dspecialtyansweringservice.net
www.zpecialtyansweringservice.net
www.szpecialtyansweringservice.net
www.zspecialtyansweringservice.net
www.xpecialtyansweringservice.net
www.sxpecialtyansweringservice.net
www.xspecialtyansweringservice.net
www.apecialtyansweringservice.net
www.sapecialtyansweringservice.net
www.aspecialtyansweringservice.net
www.secialtyansweringservice.net
www.soecialtyansweringservice.net
www.spoecialtyansweringservice.net
www.sopecialtyansweringservice.net
www.slecialtyansweringservice.net
www.splecialtyansweringservice.net
www.slpecialtyansweringservice.net
www.spcialtyansweringservice.net
www.spwcialtyansweringservice.net
www.spewcialtyansweringservice.net
www.spwecialtyansweringservice.net
www.spscialtyansweringservice.net
www.spescialtyansweringservice.net
www.spsecialtyansweringservice.net
www.spdcialtyansweringservice.net
www.spedcialtyansweringservice.net
www.spdecialtyansweringservice.net
www.sprcialtyansweringservice.net
www.spercialtyansweringservice.net
www.sprecialtyansweringservice.net
www.speialtyansweringservice.net
www.spexialtyansweringservice.net
www.specxialtyansweringservice.net
www.spexcialtyansweringservice.net
www.spedialtyansweringservice.net
www.specdialtyansweringservice.net
www.spefialtyansweringservice.net
www.specfialtyansweringservice.net
www.spefcialtyansweringservice.net
www.spevialtyansweringservice.net
www.specvialtyansweringservice.net
www.spevcialtyansweringservice.net
www.specaltyansweringservice.net
www.specualtyansweringservice.net
www.speciualtyansweringservice.net
www.specuialtyansweringservice.net
www.specjaltyansweringservice.net
www.specijaltyansweringservice.net
www.specjialtyansweringservice.net
www.speckaltyansweringservice.net
www.specikaltyansweringservice.net
www.speckialtyansweringservice.net
www.specoaltyansweringservice.net
www.specioaltyansweringservice.net
www.specoialtyansweringservice.net
www.speciltyansweringservice.net
www.speciqltyansweringservice.net
www.speciaqltyansweringservice.net
www.speciqaltyansweringservice.net
www.speciwltyansweringservice.net
www.speciawltyansweringservice.net
www.speciwaltyansweringservice.net
www.specisltyansweringservice.net
www.speciasltyansweringservice.net
www.specisaltyansweringservice.net
www.specizltyansweringservice.net
www.speciazltyansweringservice.net
www.specizaltyansweringservice.net
www.speciatyansweringservice.net
www.speciaptyansweringservice.net
www.specialptyansweringservice.net
www.speciapltyansweringservice.net
www.speciaotyansweringservice.net
www.specialotyansweringservice.net
www.speciaoltyansweringservice.net
www.speciaktyansweringservice.net
www.specialktyansweringservice.net
www.speciakltyansweringservice.net
www.specialyansweringservice.net
www.specialryansweringservice.net
www.specialtryansweringservice.net
www.specialrtyansweringservice.net
www.specialfyansweringservice.net
www.specialtfyansweringservice.net
www.specialftyansweringservice.net
www.specialgyansweringservice.net
www.specialtgyansweringservice.net
www.specialgtyansweringservice.net
www.specialyyansweringservice.net
www.specialtyyansweringservice.net
www.specialytyansweringservice.net
www.specialtansweringservice.net
www.specialttansweringservice.net
www.specialtytansweringservice.net
www.specialttyansweringservice.net
www.specialtgansweringservice.net
www.specialtygansweringservice.net
www.specialthansweringservice.net
www.specialtyhansweringservice.net
www.specialthyansweringservice.net
www.specialtuansweringservice.net
www.specialtyuansweringservice.net
www.specialtuyansweringservice.net
www.specialtynsweringservice.net
www.specialtyqnsweringservice.net
www.specialtyaqnsweringservice.net
www.specialtyqansweringservice.net
www.specialtywnsweringservice.net
www.specialtyawnsweringservice.net
www.specialtywansweringservice.net
www.specialtysnsweringservice.net
www.specialtyasnsweringservice.net
www.specialtysansweringservice.net
www.specialtyznsweringservice.net
www.specialtyaznsweringservice.net
www.specialtyzansweringservice.net
www.specialtyasweringservice.net
www.specialtyabsweringservice.net
www.specialtyanbsweringservice.net
www.specialtyabnsweringservice.net
www.specialtyahsweringservice.net
www.specialtyanhsweringservice.net
www.specialtyahnsweringservice.net
www.specialtyajsweringservice.net
www.specialtyanjsweringservice.net
www.specialtyajnsweringservice.net
www.specialtyamsweringservice.net
www.specialtyanmsweringservice.net
www.specialtyamnsweringservice.net
www.specialtyanweringservice.net
www.specialtyanwweringservice.net
www.specialtyanswweringservice.net
www.specialtyanwsweringservice.net
www.specialtyaneweringservice.net
www.specialtyanseweringservice.net
www.specialtyanesweringservice.net
www.specialtyandweringservice.net
www.specialtyansdweringservice.net
www.specialtyandsweringservice.net
www.specialtyanzweringservice.net
www.specialtyanszweringservice.net
www.specialtyanzsweringservice.net
www.specialtyanxweringservice.net
www.specialtyansxweringservice.net
www.specialtyanxsweringservice.net
www.specialtyanaweringservice.net
www.specialtyansaweringservice.net
www.specialtyanasweringservice.net
www.specialtyanseringservice.net
www.specialtyansqeringservice.net
www.specialtyanswqeringservice.net
www.specialtyansqweringservice.net
www.specialtyansaeringservice.net
www.specialtyanswaeringservice.net
www.specialtyansseringservice.net
www.specialtyanswseringservice.net
www.specialtyanssweringservice.net
www.specialtyanseeringservice.net
www.specialtyansweeringservice.net
www.specialtyanswringservice.net
www.specialtyanswwringservice.net
www.specialtyanswewringservice.net
www.specialtyanswsringservice.net
www.specialtyanswesringservice.net
www.specialtyanswdringservice.net
www.specialtyanswedringservice.net
www.specialtyanswderingservice.net
www.specialtyanswrringservice.net
www.specialtyanswerringservice.net
www.specialtyanswreringservice.net
www.specialtyansweingservice.net
www.specialtyansweeingservice.net
www.specialtyanswereingservice.net
www.specialtyanswedingservice.net
www.specialtyanswerdingservice.net
www.specialtyanswefingservice.net
www.specialtyanswerfingservice.net
www.specialtyanswefringservice.net
www.specialtyanswetingservice.net
www.specialtyanswertingservice.net
www.specialtyanswetringservice.net
www.specialtyanswerngservice.net
www.specialtyanswerungservice.net
www.specialtyansweriungservice.net
www.specialtyansweruingservice.net
www.specialtyanswerjngservice.net
www.specialtyanswerijngservice.net
www.specialtyanswerjingservice.net
www.specialtyanswerkngservice.net
www.specialtyanswerikngservice.net
www.specialtyanswerkingservice.net
www.specialtyanswerongservice.net
www.specialtyansweriongservice.net
www.specialtyansweroingservice.net
www.specialtyanswerigservice.net
www.specialtyansweribgservice.net
www.specialtyanswerinbgservice.net
www.specialtyansweribngservice.net
www.specialtyanswerihgservice.net
www.specialtyanswerinhgservice.net
www.specialtyanswerihngservice.net
www.specialtyanswerijgservice.net
www.specialtyanswerinjgservice.net
www.specialtyanswerimgservice.net
www.specialtyanswerinmgservice.net
www.specialtyanswerimngservice.net
www.specialtyanswerinservice.net
www.specialtyanswerinfservice.net
www.specialtyansweringfservice.net
www.specialtyanswerinfgservice.net
www.specialtyanswerinvservice.net
www.specialtyansweringvservice.net
www.specialtyanswerinvgservice.net
www.specialtyanswerintservice.net
www.specialtyansweringtservice.net
www.specialtyanswerintgservice.net
www.specialtyanswerinbservice.net
www.specialtyansweringbservice.net
www.specialtyanswerinyservice.net
www.specialtyansweringyservice.net
www.specialtyanswerinygservice.net
www.specialtyanswerinhservice.net
www.specialtyansweringhservice.net
www.specialtyansweringervice.net
www.specialtyansweringwervice.net
www.specialtyansweringswervice.net
www.specialtyansweringwservice.net
www.specialtyansweringeervice.net
www.specialtyansweringseervice.net
www.specialtyansweringeservice.net
www.specialtyansweringdervice.net
www.specialtyansweringsdervice.net
www.specialtyansweringdservice.net
www.specialtyansweringzervice.net
www.specialtyansweringszervice.net
www.specialtyansweringzservice.net
www.specialtyansweringxervice.net
www.specialtyansweringsxervice.net
www.specialtyansweringxservice.net
www.specialtyansweringaervice.net
www.specialtyansweringsaervice.net
www.specialtyansweringaservice.net
www.specialtyansweringsrvice.net
www.specialtyansweringswrvice.net
www.specialtyansweringsewrvice.net
www.specialtyansweringssrvice.net
www.specialtyansweringsesrvice.net
www.specialtyansweringsservice.net
www.specialtyansweringsdrvice.net
www.specialtyansweringsedrvice.net
www.specialtyansweringsrrvice.net
www.specialtyansweringserrvice.net
www.specialtyansweringsrervice.net
www.specialtyansweringsevice.net
www.specialtyansweringseevice.net
www.specialtyansweringserevice.net
www.specialtyansweringsedvice.net
www.specialtyansweringserdvice.net
www.specialtyansweringsefvice.net
www.specialtyansweringserfvice.net
www.specialtyansweringsefrvice.net
www.specialtyansweringsetvice.net
www.specialtyansweringsertvice.net
www.specialtyansweringsetrvice.net
www.specialtyansweringserice.net
www.specialtyansweringsercice.net
www.specialtyansweringservcice.net
www.specialtyansweringsercvice.net
www.specialtyansweringserfice.net
www.specialtyansweringservfice.net
www.specialtyansweringsergice.net
www.specialtyansweringservgice.net
www.specialtyansweringsergvice.net
www.specialtyansweringserbice.net
www.specialtyansweringservbice.net
www.specialtyansweringserbvice.net
www.specialtyansweringservce.net
www.specialtyansweringservuce.net
www.specialtyansweringserviuce.net
www.specialtyansweringservuice.net
www.specialtyansweringservjce.net
www.specialtyansweringservijce.net
www.specialtyansweringservjice.net
www.specialtyansweringservkce.net
www.specialtyansweringservikce.net
www.specialtyansweringservkice.net
www.specialtyansweringservoce.net
www.specialtyansweringservioce.net
www.specialtyansweringservoice.net
www.specialtyansweringservie.net
www.specialtyansweringservixe.net
www.specialtyansweringservicxe.net
www.specialtyansweringservixce.net
www.specialtyansweringservide.net
www.specialtyansweringservicde.net
www.specialtyansweringservidce.net
www.specialtyansweringservife.net
www.specialtyansweringservicfe.net
www.specialtyansweringservifce.net
www.specialtyansweringservive.net
www.specialtyansweringservicve.net
www.specialtyansweringservivce.net
www.specialtyansweringservic.net
www.specialtyansweringservicw.net
www.specialtyansweringservicew.net
www.specialtyansweringservicwe.net
www.specialtyansweringservics.net
www.specialtyansweringservices.net
www.specialtyansweringservicse.net
www.specialtyansweringservicd.net
www.specialtyansweringserviced.net
www.specialtyansweringservicr.net
www.specialtyansweringservicer.net
www.specialtyansweringservicre.net